PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G175600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 537aa    MW: 56924.9 Da    PI: 6.4762
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G175600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31115168255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Seita.4G175600.1.p 115 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 168
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-29111169IPR009057Homeodomain-like
PROSITE profilePS5129412.601111171IPR017930Myb domain
SuperFamilySSF466895.38E-14114169IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-22115170IPR006447Myb domain, plants
PfamPF002499.4E-9116167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MGEEKEKVVM EILEDDEKRS SENSVPSAVL DLNEGFGEGS DGGEVGEDAD DDDVEEEEDY  60
EGGSTSEVAG AGSSNSSSNH NSGSNMDHDM NSGSKGEGSS ERAPAVRQYN RSKLPRLRWT  120
PDLHMAFVHA VERLGGQERA TPKLVLQMMN VRGLSIAHVK SHLQMYRSKK LDHESGHERA  180
AISSVFSPMG FHMRRGDQRF HDMFFQRAAG SAISSRLLHA GGFFGSRNAV SPEASRLFGL  240
LQRRQPTMQT FDFKNYSSLR NQEWTFSQHA AAAARAGAIN DHGPARGLIH DMIFRKDGKP  300
TSHLFDVRDA IASNRTSSAA AAGGATDHGG RIGSSDWIGS SSRPLSRTTS AAAASTGFAL  360
GSLHLLSKGM RGAAAGSNGY HPNGDANTTS SDPVVTREAL GSRLETHLVE PKNPSKVIGE  420
MRTGTPAKRT KASMEENGGG SGMPDLQLSL SPNVGGDADK AKKRKILSIA LSEQEEVDSD  480
KMLPLSLSLS LRGGDSGGEG SGGDAGRLEA ETGSSSKKAV LGLSTLDLTM SIKALE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432231e-120AC243223.1 Panicum virgatum clone PV_ABa006-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965558.10.0PREDICTED: uncharacterized protein LOC101779064
TrEMBLK3XWK40.0K3XWK4_SETIT; Uncharacterized protein
STRINGSi006312m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-35G2-like family protein